PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF008800180CFD_t1
Common NameTRAES_3BF008800180CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 539aa    MW: 58134.6 Da    PI: 4.8988
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF008800180CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.51.7e-39157216261
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                              ++k+++cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrk+k+s
  TRAES3BF008800180CFD_t1 157 PDKIIPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGSMRNVPVGAGRRKSKNS 216
                              7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-31154214IPR003851Zinc finger, Dof-type
PfamPF027019.4E-32159215IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.761161215IPR003851Zinc finger, Dof-type
PROSITE patternPS013610163199IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MSDQMDSGIK LFGRVIPLVP DAAPGPPEAE ATAGSEHPPP PPPPASEAEP EADNNKEQHK  60
ETEDKGDSEM KVDAPEEKED SAMKGDEPRE RKDNEMEVDA PQAKENAETA SSSTLDHKKD  120
DQAQISNTEE KAASDPKEEN EKKSNDESGQ VKVLKKPDKI IPCPRCNSMD TKFCYYNNYN  180
VNQPRHFCKN CQRYWTAGGS MRNVPVGAGR RKSKNSALHY RQLLMAPDCL LGSRVHISNT  240
VNPEVLASLP SIPTQSASRS ETVLKFGPEV PLCESMVSVL NIEEQNVTNA GSVPRDETRE  300
DNSCTSSTTS NNGLPANAVL PGQNGAPVYC NGVGPVPQYY LGAPFMYPWS MGWNNLPVMV  360
PGGSMPESAS PSESCSTSSA PWMNSPMMPG SRLPAPPFPY PLVPPALWGC LPNWPAAAWN  420
TPWIGTNGCI SPSGSSNSSC SGNGSPTLGK HSRDSNPQKD DKEEKSLWVP KTLRIDDPDE  480
AAKSSIWATL GIKPGDPGAF KPFQFKGESK GQPADARPAR ALQANPAAFS RSQSFQESS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565622.20.0PREDICTED: cyclic dof factor 2-like
TrEMBLA0A077RZR20.0A0A077RZR2_WHEAT; Uncharacterized protein
STRINGMLOC_56598.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-44cycling DOF factor 2
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]